PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g004670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family VOZ
Protein Properties Length: 477aa    MW: 53594.7 Da    PI: 6.2999
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g004670.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ415.21.2e-1271994181217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                       pppsaflgpkcalwdc+rpa gs+w+   qdycs +ha+la neg pg  pv+rp gi+lkd+llf+alsak++gkevg+pecegaatakspw
  Sopen10g004670.1 199 PPPSAFLGPKCALWDCPRPAMGSDWCqksQDYCSDYHASLAPNEGYPGRPPVVRPMGIGLKDNLLFQALSAKAHGKEVGVPECEGAATAKSPW 291
                       89***********************944459************************************************************** PP

               VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalaly 183
                       na+elfdl+++ege irewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m+efgglkrsyymdpqp++++ewhlyeyein++da+aly
  Sopen10g004670.1 292 NAPELFDLKVVEGEVIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQMMNEFGGLKRSYYMDPQPMKNLEWHLYEYEINKYDACALY 384
                       ********************************************************************************************* PP

               VOZ 184 rlelklvdekksakgkvskdsladlqkklgrlta 217
                       rlelklvd+kk +kgk+s+ s+adlqk++grlta
  Sopen10g004670.1 385 RLELKLVDGKKIPKGKISNVSVADLQKQMGRLTA 418
                       ********************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MRKVSKRGAC KSASHQLFKD RAKNRVDDLQ GVLTNLQSAR KESRTYDVGL LEEQVHQMLR  60
EWKSELNEPS PASSLQGGSR VSSSADIYRL LLGEEEDDAT SALAAPKPEP DAQKVSITGF  120
QEGFNVTQVL QEQGFQLVDQ CKGLPLMVNN TGVNNLGIAT QLDYHSFDLH HEYDQQYLPG  180
FDALNLCLED AMPPIHISPP PSAFLGPKCA LWDCPRPAMG SDWCQKSQDY CSDYHASLAP  240
NEGYPGRPPV VRPMGIGLKD NLLFQALSAK AHGKEVGVPE CEGAATAKSP WNAPELFDLK  300
VVEGEVIREW LFFDKPRRAF ESGNRKQRSL PDYNGRGWHE SRKQMMNEFG GLKRSYYMDP  360
QPMKNLEWHL YEYEINKYDA CALYRLELKL VDGKKIPKGK ISNVSVADLQ KQMGRLTAEF  420
PLDNKRTVKG RVKANMKNMG NIHAAPVPIV PICEGFDYGN TDPYDYLLDD LDGYFIT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0145160.0BT014516.1 Lycopersicon esculentum clone 133906R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015056071.10.0PREDICTED: transcription factor VOZ1
RefseqXP_015056070.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLK4CY640.0K4CY64_SOLLC; Uncharacterized protein
STRINGSolyc10g008880.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein